PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA60G00100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 279aa    MW: 32248.4 Da    PI: 7.1457
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA60G00100genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.48.1e-141462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+d +++ G   +W + +++ g++R++k+c++rw++yl
       AA60G00100 14 RGPWSPEEDAKLKDFIHKQGAVgNWIALPHKAGLKRCGKSCRLRWLNYL 62
                     89******************879************************97 PP

2Myb_DNA-binding41.62.9e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eEd ++  +++  G++ W+ Ia+++  gRt++++k++w++
       AA60G00100  69 GDFTEEEDHIICTLFASIGSR-WSVIAAHLH-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.165962IPR017930Myb domain
SuperFamilySSF466891.14E-2511109IPR009057Homeodomain-like
SMARTSM007174.1E-101364IPR001005SANT/Myb domain
PfamPF002491.3E-121462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-231569IPR009057Homeodomain-like
CDDcd001676.33E-71662No hitNo description
PROSITE profilePS5129421.41263117IPR017930Myb domain
SMARTSM007171.8E-1067115IPR001005SANT/Myb domain
PfamPF002493.5E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2370117IPR009057Homeodomain-like
CDDcd001672.15E-671113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009785Biological Processblue light signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDAKLKDFIH KQGAVGNWIA LPHKAGLKRC GKSCRLRWLN  60
YLRPNIRHGD FTEEEDHIIC TLFASIGSRW SVIAAHLHGR TDNDIKNYWN TKLKKKLMAT  120
MAPPPPSMAS PSNKLLTPHD GMMMTMMMMD QQQSRHYYQQ DMGILVNSPC NNNNKDIMNH  180
EEENQKESTK KGIMLLNDVR SGSSTTSTIT SVKMEEHYDH YHDHGHHHHQ DDHQDQERVL  240
IEDYGMEEIK QLISSSCTSS SNTLWFDENK TDDKFMLYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-22141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195771e-111AY519577.1 Arabidopsis thaliana MYB transcription factor (At2g36890) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013669891.11e-124PREDICTED: transcription factor RAX2-like
SwissprotQ9SJL71e-118RAX2_ARATH; Transcription factor RAX2
TrEMBLA0A078H3J01e-124A0A078H3J0_BRANA; BnaC04g08340D protein
STRINGBra017218.1-P1e-117(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.11e-109MYB family protein